PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G280500.1
Common NameB456_008G280500, LOC105765572
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 831aa    MW: 88423.1 Da    PI: 5.7982
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G280500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like75.28.6e-24208261155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k +++Wt++LH++F+ea++q+ G e+A+Pk+ile m+  gLt+e+v+SHLQkYR+
  Gorai.008G280500.1 208 KHKIVWTNTLHNQFLEALRQI-GLERAVPKKILERMNSTGLTRENVASHLQKYRI 261
                         6799*****************.********************************6 PP

2Response_reg80.17.4e-27161211107
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH.ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd.pDlillDiempgmdGlellkeireeepklpiivvtahgeeedaleal 90 
                         +l+vdD+ + + ++  +l++ +y ev++++++ +al  l+ +  +Dl+++D+ mpgm+G+el k+i++e  klp+i++++ ++e+ +le l
  Gorai.008G280500.1  16 ILVVDDDSTSLAIVSAMLREFRY-EVTSVKTPAAALSVLRSNPsIDLVVTDLHMPGMNGIELQKRINKEF-KLPVIIMSSDDDENVMLESL 104
                         89*********************.***************99999**********************9999.9******************* PP

                         HTTESEEEESS--HHHH CS
        Response_reg  91 kaGakdflsKpfdpeel 107
                           Ga  f++Kp+dp  l
  Gorai.008G280500.1 105 AGGAVFFIVKPVDPVGL 121
                         ************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23009.0E-3412162No hitNo description
SuperFamilySSF521721.42E-3113130IPR011006CheY-like superfamily
SMARTSM004481.8E-2714125IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011038.94215129IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.0E-2216122IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.86E-2717118No hitNo description
PROSITE profilePS512949.584205264IPR017930Myb domain
SuperFamilySSF466896.81E-17206265IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-23206265IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23208261IPR006447Myb domain, plants
PfamPF002496.2E-6213260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 831 aa     Download sequence    Send to blast
MVSTRSVNSP AMKITILVVD DDSTSLAIVS AMLREFRYEV TSVKTPAAAL SVLRSNPSID  60
LVVTDLHMPG MNGIELQKRI NKEFKLPVII MSSDDDENVM LESLAGGAVF FIVKPVDPVG  120
LKNVWQYAVA AKKGKSLLIE DMDRESSSSS PADGKLSLGG NTKSVSSVNN EKNDPKNGSK  180
RKGASGKGRD KDDNDDESKS PPPKKTKKHK IVWTNTLHNQ FLEALRQIGL ERAVPKKILE  240
RMNSTGLTRE NVASHLQKYR IFLKRLAERG CFASKAVIDR FLKSNFAAGH PLLLKTAQEY  300
SRLEHMERLR VLASYPGLRE SLMGHSSTGS VPLFYGHPGA SSSNAAQQPL GYGQSRLLSN  360
QTNQPLFPGS GNMLNNPYLN NRVGYGNGIG IGIGIGSSSS VNGGGGFSSG LLNGGNSSLT  420
YPNQVQARPD FYNAGPSSSS PFRFGSAGFH SSGSTLGNGL FGSGSSSYPS LNSSSSGSTV  480
VNGLFGSSSR SHPSLNSSSS GATLGNGLFG SSSSSYPSLN NSSYPSLNPG YTNNAANSYR  540
GMRFYEHLLN GSAPPLTGDY GSMNQTRPTG DYGSMNRTHN ENINVPTMRT TPLDSLDFMR  600
EFPIPPVDSS TLIQGLGTGN TRLTEINSDQ LLNNVPNLGN EPRGGDGLLQ DLVLESKKLA  660
NKEKAGEQSV ENSDYCLPSL FPEIYPTLDE LLNCDFPDPL SDEDNHPWSE EAIGQVQSEL  720
EELINNPNPA AGDGSNESNP VTNKQQTGGE QVTVTHPLSN VLQVMTAPAP APASAPAPAP  780
APAPAPAPAL AVYNSANNAN NGAPVGANSS SYEDDEDFLD SLLNFNDEFE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-19207267464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5836311e-66JX583631.1 Gossypium hirsutum clone NBRI_GE16723 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440209.10.0PREDICTED: uncharacterized protein LOC105765572 isoform X1
TrEMBLA0A0D2T8D10.0A0A0D2T8D1_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM162131014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07210.15e-49response regulator 21
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]